PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610833.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 288aa    MW: 32629.7 Da    PI: 9.378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610833.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61.1e-1655100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W   Ed +l+++v  +G+ +W+ Ia++m+ gRt+k+c++rw++ 
   XP_013610833.1  55 RGHWRVSEDSQLAELVSVHGPQNWNHIAEKMQ-GRTGKSCRLRWFNQ 100
                      899*****************************.***********996 PP

2Myb_DNA-binding45.41.9e-14109151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ eE+e+l+ a+  +G++ W+ Ia+ ++ gRt++ +k++w+ +
   XP_013610833.1 109 VFSVEEEERLLAAHGAFGNK-WAMIAKIFN-GRTDNALKNHWHVL 151
                      699*****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.93950101IPR017930Myb domain
SMARTSM007172.9E-1354103IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-2655152IPR009057Homeodomain-like
PfamPF002495.5E-1655100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2456108IPR009057Homeodomain-like
CDDcd001677.52E-125899No hitNo description
PROSITE profilePS5129424.161102156IPR017930Myb domain
SMARTSM007174.0E-12106154IPR001005SANT/Myb domain
PfamPF002497.2E-11108151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-18109156IPR009057Homeodomain-like
CDDcd001671.28E-8110152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDISFFQAYP FDLPCSRAFN GDGENNAVEF SNKRMMVKVS DESKKKQRGS RVCSRGHWRV  60
SEDSQLAELV SVHGPQNWNH IAEKMQGRTG KSCRLRWFNQ LDPRINKRVF SVEEEERLLA  120
AHGAFGNKWA MIAKIFNGRT DNALKNHWHV LMARKLRQQS SSYTRRFNGS AHKPNADHTS  180
FNISPGSVDD EEVNMEKNSW KILKEGTTNM KAQYPQEEYC SPRMPMHGHY STFSADSLAL  240
TLHVSIQEPS SSLSSLSLPS SSAEYTMVAT KPPAFIDFLG VGHQSLNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-28551564105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-28551564105C-Myb DNA-Binding Domain
1msf_C6e-28551564105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610833.10.0PREDICTED: transcription factor MYB57-like
TrEMBLA0A0D3E0M00.0A0A0D3E0M0_BRAOL; Uncharacterized protein
STRINGscaffold_500894.11e-147(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-143myb domain protein 110